PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02033.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 292aa    MW: 31336.3 Da    PI: 8.2771
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02033.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.3e-383999262
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             ++++lkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  Rsa1.0_02033.1_g00004.1 39 HHQSLKCPRCNSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRSK 99
                             57899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-343197IPR003851Zinc finger, Dof-type
PfamPF027015.3E-334197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5344397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MQDIHDYSMT GGGSTGRFYG GGGGGDRRMR AHQNNILNHH QSLKCPRCNS LNTKFCYYNN  60
YNLSQPRHFC KNCRRYWTKG GVLRNVPVGG GCRKAKRSKS KQEQPPSSSA DKTTTQDVEE  120
KSTSSESSSL TASNTTVPTA VTTTTTATAA AVKVAPSGFV DTDKPNLKLY GNGTEWSGLL  180
GQGSSDGGAS SEVGGFAVAA IGPTSFGYGG SSVNQLCIAD HLKLEGNTVH QQFGDPTAQI  240
NPDMGYEPLD WGSGGGDQTL FDLTSTVDHA YWSRSQWRSS NHQDDRNGLY LP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136402.11e-139PREDICTED: dof zinc finger protein DOF5.4
RefseqXP_013700840.11e-138PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR01e-124DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLM4D9431e-139M4D943_BRARP; Uncharacterized protein
STRINGBra013003.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-102OBF binding protein 4